The maximum safe operating temperature that the engineer should recommend for this reaction is 590°C.
What is high-pressure gas reaction vessel?Chemical reaction vessel that can conduct a reaction under elevated pressure (that is greater than atmospheric pressure) is called high pressure reaction vessel.
As the reaction is to performed in the cylindrical vessel, so volume of the cylindrical vessel will be:
Volume of cylinder =π r² h
Given r is 17 cm and h is 20.4 cm
= 22.17 * 17² * 20.4
= 4.630 cm²
As we know that: PV = nRT
moles = weight/molecular weight
moles of boron trifluoride = 98.5/67.82
moles of boron trifluoride = 1.452 mol
PV = nRT
T = PV/nR
T = (22.21 * 4.630)/( 0.0826 * 1.452)
= 863 K
= 863 - 273°C
= 590°C
Temperature of the system is: 590°C
To know more about high-pressure gas reaction, refer
https://brainly.com/question/18404475
#SPJ4
Note: The question given on the portal is incomplete. Here is the complete question.
Question: A chemical engineer must calculate the maximum safe operating temperature of a high-pressure gas reaction vessel. The vessel is a stainless-steel cylinder that measures 17.0cm wide and 20.4cm high. The maximum safe pressure inside the vessel has been measured to be 2.20MPa. For a certain reaction the vessel may contain up to 0.0985kg of boron trifluoride gas. Calculate the maximum safe operating temperature the engineer should recommend for this reaction. Write your answer in degrees Celsius. Round your answer to significant digits.
Physical methods of monitoring the rate of a chemical reaction
There are several physical methods that can be used to monitor the rate of a chemical reaction are; Spectrophotometry, Conductometry, and Turbidity measurement
Spectrophotometry involves measuring the changes in the intensity of light absorbed or transmitted by a solution during a chemical reaction. Spectrophotometers are used to measure the amount of light absorbed or transmitted by a sample at different wavelengths.
Conductometry involves measuring the changes in electrical conductivity of a solution during a chemical reaction. Conductivity meters are used to measure the electrical conductivity of a solution, which can change as the concentration of ions in the solution changes during a chemical reaction.
Turbidity measurement involves measuring the changes in the clarity or turbidity of a solution during a chemical reaction. Turbidimeters or nephelometers can be used to measure the amount of light scattered by a sample, which can change as particles form or dissolve during a reaction.
To know more about Spectrophotometry here
https://brainly.com/question/31440604
#SPJ1
--The given question is incomplete, the complete question is
"What are the physical methods of monitoring the rate of a chemical reaction?"--
A thermometer is placed in water in order to measure the water’s temperature. What would cause the liquid in the thermometer to rise? The molecules in the water move closer together. The molecules in the thermometer’s liquid spread apart. The kinetic energy of the water molecules decreases. The kinetic energy of the thermometer’s liquid molecules decreases.
Answer: The molecules in the thermometer's liquid spread apart.
Explanation:
Mercury is the only metal that remains liquid at room temperature. It has a high coefficient of expansion therefore the its level rises when exposed to a temperature range. It can detect a slight change in temperature. It has a high boiling point.
When the thermometer is placed in the water to measure the temperature, the molecules of thermometer liquid that is mercury only will spread due to high coefficient of expansion. This can be seen as rise in temperature.
Answer:
B
Explanation:
Just did the test
An clement X has 2 electrons in K shell, 8 electrons in L shell and 5 electrons in i Size of X ion is greater than that of X atom though both contain the same protons. Give reason. ii) Write down the formula of one of the compounds of X where X is in -3 oxidation.
Answer:
i) The size of X ion is greater than that of X atom even though both contain the same number of protons because the ion has fewer electrons compared to the atom. When an atom forms an anion (negative ion), it gains electrons, which causes increased electron-electron repulsion. This repulsion causes the electron cloud to expand, and as a result, the ion becomes larger than the neutral atom.
In the case of element X, when it forms an ion with a -3 charge, it will gain 3 more electrons, increasing the total number of electrons to 18. This will cause the size of the X ion to be larger than the neutral X atom.
ii) To determine the compound of X in the -3 oxidation state, we first need to determine the element's identity. We know that X has 15 electrons in total (2 in the K shell, 8 in the L shell, and 5 in the M shell). Therefore, X has an atomic number of 15, which corresponds to phosphorus (P).
Since phosphorus is in the -3 oxidation state, it gains 3 electrons and becomes P^3-. To form a compound, we need a cation that can balance the negative charge. A common example is aluminum (Al), which has a +3 charge (Al^3+). When phosphorus and aluminum combine, they form the compound aluminum phosphide with the formula AlP.
Which of the following best represents potential energy being converted to kinetic energy? HELP
A) A man jogs and stops to drink an energy drink
B) A drawn bow is released, causing an arrow to fly across the field
C) A roller coaster rounds a curve and climbs the next hill
D) A tree is struck by lighting, and then it is set on fire
Answer:
B) A drawn bow is released, causing an arrow to fly across the field
Explanation:
Potential energy can be thought of as "potential" to do something. For eg, putting a ball on top of hill causes the ball to have the potential to roll down the hill if released. Here the ball converts the potential energy into kinetic energy (energy of motion) to roll down.
Similarly, the bow has been stretched (potential to fly if released), and when its released, it converts the potential energy into kinetic energy.
Now name the molecules: use prefixes!! 1) CO2: 2) N203: 3) SeCl: 4) XeF: 5) S;Brs:
What is the mass of 2.25 moles of sulfuric acid (H2 SO4)?
Answer:
The molar mass of sulfuric acid (H2SO4) can be calculated by adding the atomic masses of its constituent atoms:
Molar mass of H2SO4 = 2(1.008 g/mol) + 1(32.06 g/mol) + 4(15.99 g/mol) = 98.08 g/mol
Therefore, the mass of 2.25 moles of H2SO4 is:
mass = number of moles x molar mass
mass = 2.25 moles x 98.08 g/mol = 220.68 g
So, the mass of 2.25 moles of sulfuric acid is 220.68 grams.
Please help me answer this question I need it before 12:59
Answer:
because the brian is like a computer because that both use electrical signals to send messages the brain uses chemicals to transmit information and the computer uses electricity.
Hope that was helpful
the presidential inauguration is free to watch with or without paying ror traditional tv service. Why is this important?
Answer:
so that people would be able to witness the inauguration of a president, since a president is an important part of a country.
Explanation:
An error during which cellular process would create a gene mutation?
An error during DNA replication would create a gene mutation.
During DNA replication, the genetic information in a cell is copied to make new DNA molecules. However, mistakes can occur during this process, leading to changes in the DNA sequence, which can result in a mutation. Mutations can also be caused by exposure to environmental factors, such as radiation or chemicals, which can damage the DNA molecule directly or affect the cellular processes involved in DNA replication.
Mutations can have a variety of effects on the organism, ranging from no effect to causing serious health problems or even death. Gene mutations can also be inherited from a parent, which can result in genetic disorders or predisposition to certain diseases. Therefore, it is important to understand the mechanisms of gene mutations and their potential impacts on organisms.
To know more about the Gene mutation, here
https://brainly.com/question/15448555
#SPJ1
The Moon's is waning when it changes from?
A. First quarter to a full moon
B. Last quarter to a new moon
C. First quarter to a new moon
Answer:
B. Last quarter yo a new moon
Explanation:
The moon is called a waning moon when it is in the phase in which its visible surface area is getting smaller.
Answer:
B. Last quarter to a new moon
Identify the reactants and products,explain what the (aq) and (s) represent in the reaction in the washing machine
In a chemical reaction, usually, we have something very standard, whatever is on the left side of the arrow will be Reactant, and whatever comes after the arrow will be product, so for this reaction:
Na2CO3 (aq) + MgSO4 (aq) -> Na2SO4 (aq) + MgCO3 (s)
The reactants will be: Na2CO3 and MgSO4
The products will be: Na2SO4 and MgCO3
The aq or s representation means the physical state in which the compound will be found in water, if it is aq, this means that the compound will dissolve in water and it will be found in an aqueous state. If the letter is s, therefore the compound will be a solid in water, forming a precipitate.
Since we have a double change in the positions of the elements, this will be called a Double Displacement reaction, in which we have:
AB + CD -> AC + BD
Reflect on the learning activities titled “Hypothesis”, “Variables and Hypothesis” and “Constructing a Hypothesis”. Describe some similarities and differences between a question that comes in response to an observation, and a scientific research question? Cite quotes from the readings to support your answer. Where do variables fit into this thinking? In other words, if you imagine a number line with observation questions at one end and scientific research questions at the other, what role do variables play anywhere along this continuum?
Hypothesis is a proposed explanation for an observable phenomenon. The term comes from the Greek word for "to suppose." Variables, on the other hand, are anything that can be changed or measured. Variables can be independent, dependent, or control variables. Learning activities titled “Hypothesis”, “Variables and Hypothesis” and “Constructing a Hypothesis” share similarities and differences with a question that comes in response to an observation and a scientific research question.
On the other hand, "A scientific research question is more specific and usually relates to a hypothesis. For example, if you hypothesize that birds are attracted to gardens that have bird feeders, your research question might be, 'Does the presence of bird feeders in a garden attract more birds?'" Variables can fit anywhere along this continuum. Variables are anything that can be changed or measured. If you imagine a number line with observation questions at one end and scientific research questions at the other, variables can be used to test hypotheses, support or refute a claim. Variables can be independent, dependent, or control variables. Independent variables are variables that can be manipulated. Dependent variables are variables that depend on the independent variable. Control variables are variables that remain constant throughout the experiment.In conclusion, learning activities titled “Hypothesis”, “Variables and Hypothesis” and “Constructing a Hypothesis” share similarities and differences with a question that comes in response to an observation and a scientific research question. A question that comes in response to an observation is usually general and qualitative while a scientific research question is specific and quantitative. Variables can fit anywhere along the continuum and can be used to test hypotheses, support or refute a claim.For such more question on Hypothesis
https://brainly.com/question/606806
#SPJ8
Addison warms a pure solid substance in a system closed off from the surroundings
This experiment shows that the elements of pure solid substance in a system closed off from the surroundings has increased temperature very fast.
What is a pure solid substance?Pure substances are substances that are built up of only one kind of particle and have a fixed or abiding structure. Pure substances are further confidential as elements and compounds. An element is a substance that comprises only one type or kind of atom. a pure substance has a constant chemical composition.
No affair where you sample a substance, it is the same. For chemistry, the safest examples of pure substances are elements and compounds. So, examples cover gold, silver, helium, sodium chloride, and pure water.
So we can conclude that In chemistry, a pure substance is an element or compound made up of one type of particle.
Learn more about pure substance here: https://brainly.com/question/18634105
#SPJ1
Nadia runs from her house to a fiend's house that is 24 meters away. How much time she will take to reach her friend's house, knowing that Nadia's speed is 3 m/s .
Nadia will take 8 seconds to reach her friend's house.
Speed is the measure of the distance traveled by an object per unit of time. It is a scalar quantity and is typically expressed in units such as meters per second (m/s), miles per hour (mph), or kilometers per hour (km/h).
To calculate the time Nadia will take to reach her friend's house, we can use the formula;
time = distance / speed
where distance is the amount of space traveled by an object, and time is the duration of travel.
Put the values given in the problem, we have:
time = 24 meters / 3 m/s
time = 8 seconds
Therefore, Nadia will take 8 seconds.
To know more about time here
https://brainly.com/question/15356513
#SPJ1
High tides are located at__
A an B
B an D
B an C
Answer:
b and c since they bulge
Explanation:
NF3 Draw the molecule by placing atoms on the grid and connecting them with bonds. Include all lone pairs of electrons. +- CHONSPFBrClIXMore Request Answer Part B HBr Draw the molecule by placing atoms on the grid and connecting them with bonds. Include all lone pairs of electrons. +- CHONSPFBrClIXMore Request Answer Part C SBr2 Draw the molecule by placing atoms on the grid and connecting them with bonds. Include all lone pairs of electrons. +- CHONSPFBrClIXMore Request Answer Part D CCl4 Draw the molecule by placing atoms on the grid and connecting them with bonds. Include all lone pairs of electrons. +- CHONSPFBrClIXMore Request Answer Provide Feedback
Here is the correct question.
Draw the molecule by placing atoms on the grid and connecting them with bonds. Include all lone pairs of electrons.
NF3
SBr2
CCl4
Answer:
Explanation:
The objective here is to draw the molecule three molecules by placing atoms on the grids and connecting them with their respective bonds, therefore including all the lone pairs of electrons.
See the attachment below for the diagrams.
The first compound is know as Nitrogentrifluoride. A non-flammable greenhouse gas. It is majorly used for he production of semi conductors. It has a trigonal planar structure.
SBr2: Sulfur dibromide is a yellowish liquid toxic gas. It results as a reaction between SCl_2 and HBr. Its has a Bent Structure.
CCl_4 : carbon tetrachloride has the presence of a colourless liquid with a sweet smell. Carbon tetrachloride is used for different domestic uses such as: cleaning surfaces, fumigating, cleaning metals etc. It has a tetrahedral structure.
The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first
Answer:
Follows are the solution to this question:
Explanation:
The creation of four fragments,
(n endpoint) MNQSYGR (c endpoint)
Weight of the molecular = 854.92
Load = 2
\(\to \frac{mass}{Load}\) = 427.46
(n endpoint)RLVSR (c endpoint)
Weight of the molecular = 629.76
Load = 3
\(\to \frac{mass}{Load}\)= 209.92
(n endpoint) AATAMASLIK (c endpoint)
Weight of the molecular = 976.20
Load at pH(2). = 2
\(\to \frac{mass}{Load}\)= 442.50
(n endpoint) IFAWWY (c endpoint)
Weight of the molecular = 885.03
Load= 1
\(\to \frac{mass}{Load}\)= 885.03
It is apparent that RLVSR is the smallest mass ration for this peptide that is detected in the first place.
What is the oxidation number change for the iron atom in the following reaction? 2 Fe2O3(s) + 3 C(s) → 4 Fe(s) + 3 CO2(g)
Answer:
\(\boxed{From \ +6 \ to \ 0}\)
Explanation:
2 Fe2O3(s) + 3 C(s) → 4 Fe(s) + 3 CO2(g)
In the given reaction, Iron in the reactants side have the oxidation number of +6. This is because \(O_{3}\) with \(Fe_{2}O_{3}\) has oxidation state -6, So any atom with it would have an oxidation state of +6 to give the resultant of zero.
In the products side, Iron acts as a free element reacting with no other atom. So, as per the rule of oxidation states, the oxidation state of Iron in the products side will be zero.
So, the oxidation number changes from +6 to 0 .
Extra Info: Decrease in oxidation state is Reduction , So Iron is being reduced here.
The change in the oxidation number of the iron atom in the reaction is from +3 to 0
Oxidation is simply defined as the the loss of electron. However, Oxidation number simply talks about the number of electrons that is either gained or lossed during bond formation.
The change in the oxidation number of iron in the reaction can be obtained as follow:
2Fe₂O₃(s) + 3C(s) → 4Fe(s) + 3CO₂(g)
Oxidation number of Fe in Fe₂O₃Oxidation number of Fe₂O₃ = 0 (ground state)
Oxidation number of oxygen = –2
Oxidation number of Fe =?Fe₂O₃ = 0
2Fe + 3O = 0
2Fe + 3(–2) = 0
2Fe – 6 = 0
Collect like term
2Fe = 6
Divide both side by 2
Fe = 6/2
Fe = +3Thus, the oxidation number of Fe in Fe₂O₃ is +3
Oxidation number of Fe (ground state) is zeroTherefore, the change in the oxidation number of the iron, Fe, atom in the reaction is from +3 to 0
Learn more: https://brainly.com/question/10079361
Which action would speed up the reaction for the chemical reaction CH3Br + OH → CH3OH+Br?
O reducing the pressure of the reactant mixture
O reducing the OH concentration
O cooling the reactant mixture
O increasing the CH3Br concentration
Help please 20pts
Answer: increasing the CH3Br concentration
Explanation:
if i have 2.4 moles of gas held at a temperature of 97 c and in a container with a volume of 45 L , what is the pressure of the gas
Answer:
1.62 L
Explanation:
T= 97+273.15= 370.15
R= 0.08206 atm/mol⋅K
V= 45 L
n= 2.4 mol
P= (n⋅R⋅T)/V
= (2.4 x 0.08206 x 370.15)/(45) = 1.61997 = 1.62
The pressure of the gas is 1.62 atm. This can be calculated by using ideal gas law that gives direct relation between P,V and T
Ideal gas Law:This law states that pressure and volume are directly proportional to the temperature of the gas.
What information do we have?
T= 97+273.15= 370.15 K
R= 0.08206 atm/mol⋅K
V= 45 L
n= 2.4 mol
To find:
P=?
Ideal gas law is given by:
PV=n.R.T
P= (n⋅R⋅T)/V
P= (2.4 x 0.08206 x 370.15)/(45)
P= 1.61997
P= 1.62 atm
Thus, the pressure of the gas is 1.62 atm.
Find more information about Ideal gas law here:
brainly.com/question/12873752
Answer please I give lots of points
Answer:
4
Explanation:
REACTION; C5H12 + 8O2 5CO2 + 6H2OWhen 35.5 L of C5H12 are consumed in this reaction what volume of CO2 can be produced in liters?
Using the STP (standard temperature and pressure), we can solve this problem. First, let's find the number of moles produce by 35.5 L of C5H12.
Remember that the standard temperature is 0 °C which is the same that 273 K (kelvin) and for pressure is 1 atm and the constant of ideal gas is 0.082 atm*L/(mol*K)
Let's use the formula of an ideal gas to find the number of moles:
\(\begin{gathered} PV=\text{nRT,} \\ n=\frac{PV}{RT}, \\ n=\frac{\text{1 atm }\cdot35.5\text{ L}}{0.082\frac{atm\cdot L}{mol\cdot K}\cdot273K}, \\ n(C_5H_{12})=1.58\text{6 moles} \end{gathered}\)Now, using this number of moles, we can find the number of moles produce for CO2 and we can find its volume.
You can see that in the reaction 1 mol of C5H12 produces 5 moles of CO2, so the calculation to find the number of moles of CO2, would be:
\(1.586molC_5H_{12}\cdot\frac{5molCO_2}{1molC_5H_{12}_{}}=7.93molCO_2.\)The next and final step is clear V (volume) from the initial formula and replaces the value of moles for CO2, like this:
\(\begin{gathered} V=\frac{nRT}{P}, \\ V=\frac{7.93\text{ mol}\cdot0.082\frac{atm\cdot L}{mol\cdot K}\cdot273K}{1\text{ atm}}, \\ V(CO_2)=177.52\text{ L.} \end{gathered}\)So, 25,5 L of C5H12 will produce 177.52L of CO2.
Fracture zones are cracks on the ocean floor that horizontally offset mid-ocean ridges. Fracture zones typically run perpendicular to mid-ocean ridges. The diagram below shows two tectonic plates moving apart. One plate is dark blue, and the other is light blue. Several fracture zones are shown at places where parts of the same tectonic plate are moving in the same direction but at different speeds.
Fracture zones are areas of weakness in the oceanic crust, and they form as a result of the stress of plate tectonics. They are usually narrow and can be up to several hundred kilometers in length.
What is the kilometers ?Kilometers (km) are a unit of measurement for length or distance. One kilometer is equivalent to 1000 meters and is equal to 0.6214 miles. Kilometers are commonly used to measure long distances, such as the length of a road or the distance between two cities. In science, kilometers are often used to measure the size of large objects, such as the diameter of planets, or the distance between two stars.
To learn more about kilometers
https://brainly.com/question/1640140
#SPJ1
Match the descriptions below with the graphs. Be sure to explain your answers.
What does voltage describe?
The Voltage is the pressure from the electrical circuit of the power source that passes the current.
The Voltage is defined as the pressure from the electrical circuit of the power source that will passes the charged electrons that is the current through the conducting loop, it will enable them to do work because of the illuminating the light. The in simple terms is : voltage = pressure, and it is denoted as the volts and the symbol is the V.
The voltage is described as the force that causes the flow of the charged particles. The Voltage is also called as the electromotive force.
To learn more about voltage here
https://brainly.com/question/13177389
#SPJ1
A sample of gas occupies 2.71 mL at STP.If you wanted to know its volume at 20.00C and 5.00 atm, you would use the __________ Gas LawGroup of answer choicesIdeal Gas LawCombined Gas LawDalton's Law of partial pressure
Explanation:
We know the initial volume of the gas and that it as STP; so we also know the pressure and temperature.
V₁ = 2.71 mL P₁ = 1 atm T₁ = 273.15 K
We are also given the final temperature and pressure. The final volume is our unknown.
V₂ = ? P₂ = 5.00 atm T₂ = 20.00 °C = 293.15 K
If we want to find the final volume we can directly use the combined gas law that states:
P₁ * V₁ /T₁ = P₂ * V₂/T₂
Answer: Combined Gas Law
Part B
Next, you’ll test your hypothesis from part A by examining the reaction times of vinegar and baking soda in water at four different temperatures. You’ll carry out the reaction using water at room temperature (about 25°C), 40°C, 60°C, and 80°C. Make sure that you use the same amounts of vinegar and baking soda for all three three trials.
Gather all the materials, and perform these steps for each trial:
Heat at least
cup (60 milliliters) of water to the required temperature (refer to the data table). Water may be heated on a stove, on a hot plate, or in a microwave oven.
Measure and record the actual temperature of the water.
Measure 1 tablespoon (15 milliliters) of the water into the cup.
Add
teaspoon (1.5 grams) baking soda to the water, and stir until it is dissolved. The solution will be clear.
Measure 1 tablespoon (15 milliliters) of vinegar, but do not pour it into the cup yet.
Very quickly, do all of the following:
a. Pour the measured vinegar into the cup.
b. Start the stopwatch.
c. Stir or carefully swirl the substances in the cup.
The chemical reaction will produce bubbles. You’ll be able to see the bubbles and hear them pop. Watch and listen for when the reaction stops. When it looks and sounds like it has finished, stop the stopwatch.
Record the reaction time in the data table.
Discard the solution down the drain, and rinse the cup.
Repeat steps 1–9 of this procedure, doing three trials for each water temperature. Record the average temperature and reaction time for each set of the three trials. Read this math review to know how to calculate average of a data set.
The reaction time decreases as the temperature increases of the reaction mixture increases.
A sample record of results is:
Temperature (°C) Trial 1 Trial 2 Trial 3 Average25°C 11 seconds 11 seconds 11 seconds 11 seconds40°C 8 seconds 8 seconds 8 seconds 8 seconds60°C 5 seconds 5 seconds 5 seconds 5 seconds80°C 3 seconds 3 seconds 3 seconds 3 secondsWhat is the effect of an increase in temperature on reaction time?An increase in temperature leads to an increase in reaction rate or a decrease in reaction time.
The increase in temperature provides more thermal energy to the reactant molecules, which leads to an increase in the average kinetic energy of the molecules. As a result, more reactant molecules have sufficient energy to overcome the activation energy barrier and undergo successful collisions, leading to an increased reaction rate.
Learn more about reaction time at: https://brainly.com/question/26142029
#SPJ1
Balance each of the following chemical equations
Ba(OH)2 (aq) + HNO3(aq) + Ba(NO3)2 (aq) + H2O(1)
Express your answer as a chemical equation. Identify all of the phases in your
Answer:
Below.
Explanation:
Ba(OH)2 (aq) + 2HNO3(aq) ---> Ba(NO3)2 (aq) + 2H2O(l)
PLS HELP
Explain the theory of plate tectonics and how they have changed Earth's surface over time. Include the role of plate tectonics in the creation of landforms.
Answer:
The surface of earth sits on plates that move over time because of the pressure build up underneath.When the pressure releases the pressure goes through the cracks of the plates (Or Earth) pushing them apart causing earthquakes and volcano eruptions.
Explanation: Science
Sulfur trioxide reacts with water to form sulfuric acid according to the following reaction: SO₃ + H₂O → H₂SO₄ Given the atomic mass of hydrogen is 1 amu, the atomic mass of oxygen is 16 amu, and one molecule of sulfuric acid has a mass of 98 amu, what is the atomic mass of sulfur trioxide?
Explanation:
The atomic mass of sulfur trioxide can be calculated as follows:
1 molecule of sulfuric acid has a mass of 98 amu, and it is composed of 2 hydrogen atoms, 1 sulfur atom, and 4 oxygen atoms. So, the mass of hydrogen and oxygen atoms in 1 molecule of sulfuric acid is (2 * 1 amu) + (4 * 16 amu) = 34 amu.
Therefore, the mass of sulfur in 1 molecule of sulfuric acid is 98 amu - 34 amu = 64 amu.
Since 1 molecule of sulfuric acid is formed from 1 molecule of sulfur trioxide, the atomic mass of sulfur trioxide can be calculated as 64 amu.
Sulfur trioxide reacts with water to form sulfuric acid according to the following reaction: SO₃ + H₂O → H₂SO₄ Given the atomic mass of hydrogen is 1 amu, the atomic mass of oxygen is 16 amu, and one molecule of sulfuric acid has a mass of 98 amu, the atomic mass of sulfur trioxide is 80 amu.
According to the law of conservation of mass, in a reaction, atomic mass of the reactants will be equal to atomic mass of the products if the reaction is balanced and above reaction is balanced. Hence,
Mass of SO₃ + Mass of H₂O = Mass of H₂SO₄
x + 18 = 98
x = 80 amu = Mass of SO₃
Therefore, when Sulfur trioxide reacts with water to form sulfuric acid according to the following reaction: SO₃ + H₂O → H₂SO₄ Given the atomic mass of hydrogen is 1 amu, the atomic mass of oxygen is 16 amu, and one molecule of sulfuric acid has a mass of 98 amu, the atomic mass of sulfur trioxide is 80 amu.
Learn more about atomic mass, here:
https://brainly.com/question/17067547
#SPJ2